Home Page | Information | Lay Summary | Help page | Example results

 

Welcome to PiRaNhA

PiRaNhA is a server for predicting RNA-interacting residues in protein sequences. The method is based on a Support Vector Machine created using a combination of features including: position specific scoring matrices, residue interface propensity, predicted residue accessibility and residue hydrophobicity, in overlapping subsequences. The method achieves a Matthews Correlation Coefficient (MCC) of 0.50 in a 5-fold cross-validation on a dataset of 81 known RNA-binding proteins. This server enables users to upload (single or multiple) protein sequences and obtain information on potential RNA-binding residues.

PiRaNhA requires Netscape v4.0 or Internet Explorer v4.0 and Java script enabled.
This website is free and open to all users and there is no login requirement.
You can receive results live without an email address but as the calculations take >5 minutes in most cases it is recommended you enter an email address to receive results as attached files.

Please submit a protein sequence, or sequences (maximum 10), in FASTA format:

> example protein sequence [see example results page]
MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYIT
VRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR

OR please upload a protein sequence file:


Options:

Please enter your email address if you would like to also receive your results by email:

 

© PiRaNhA Copyright
Bioinformatics Group, Univ. Sussex, UK and Laboratory of Protein Informatics, IPR, Osaka Univ., Japan, All Rights Reserved.
This work has been supported by a UK Medical Research Council (MRC) Grant

Last Update 16/12/2009